TB-4 (Full Chain)

TB-4 Full Chain (Thymosin Beta-4, full-length) is a naturally occurring actin-binding peptide widely used in research to study cell motility, cytoskeletal dynamics, and repair-associated signaling pathways.

• Common name: Thymosin Beta-4 (TB-4)

• Peptide length: 43 amino acids

• Sequence (human): SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

• CAS number: 77591-33-4

• Molecular formula: C212H350N56O78S

• Molecular weight: ~4963.44 g/mol

• PubChem CID: 45382195

• Primary research purpose: Actin (G-actin) binding/sequestration and downstream effects on cytoskeleton-driven signaling

• Common research endpoints: Cell migration markers, angiogenesis-associated signaling, extracellular matrix (ECM) remodeling indicators, and inflammation/oxidative-stress pathway panels

For research use only. Not for therapeutic or diagnostic applications.